下载
Anti-Twin-Strep-tag Antibody (SAA0348)
Overview
Catalog No. YP396033
Brand abinScience
Host species Mouse
Species reactivity General
Form Liquid
Storage buffer 0.01M PBS, pH 7.4.
Clonality Monoclonal
Isotype IgG2b
Applications ELISA, WB
Target Twin-Strep-tag, Twin Strep tag, TwinStrep tag, Streptag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Purification Protein A/G purified from cell culture supernatant.
Stability and Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
Clone IDSAA0348
Note For research use only.
Images


SDS-PAGE
SDS-PAGE for Anti-Twin-Strep-tag Antibody (SAA0348).